SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 266940.Krad_1621 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266940.Krad_1621
Domain Number 1 Region: 1-302
Classification Level Classification E-value
Superfamily Phase 1 flagellin 3.92e-58
Family Phase 1 flagellin 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 266940.Krad_1621
Sequence length 302
Comment (Kineococcus radiotolerans SRS30216)
Sequence
MLGRVTQRSIATNALTNLQNTQTRMAKLQEQITSGNSLPKGSEDSVRAAAALRLNDQIAV
NTENGRNLDEARAWMVTQEPALESTTKALQKVRELTVRASNGTFDATARKAIAAEITALK
ETILGDANTQYQGRAVFAGTSAGTVAYDATTYASNDDTNTTVTPAVGVVTRTVSPGVHMQ
VNISGNSVYGSGNDSLFAELDTLAQKITDGDPTAAASLSTIDGRITKATNAMATIGARTN
QLDHAEEVNANQLAYLEAQLNDVQGVDPAKAYVEFTQQNVAYQAALQVTAKTVQTSLLDF
LR
Download sequence
Identical sequences A6W8G8
2005137957 266940.Krad_1621 WP_011981754.1.7041 gi|152965587|ref|YP_001361371.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]