SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 267377.MMP1278 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  267377.MMP1278
Domain Number 1 Region: 6-104
Classification Level Classification E-value
Superfamily GlnB-like 8.89e-27
Family DUF190/COG1993 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 267377.MMP1278
Sequence length 109
Comment (Methanococcus maripaludis S2)
Sequence
MKKISAKLLRIYLKEEDKYGKELLINSIIKTLKTNGIAGATVFKGFCGYGTRGISRIDIL
RLSMNLPAVIECIDYEEKLNDIMPKLVEMVSENGLITIQDIDVFKELKK
Download sequence
Identical sequences Q6LXS0
WP_011171222.1.40991 gi|45358841|ref|NP_988398.1| 267377.MMP1278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]