SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 267748.MMOB0830 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  267748.MMOB0830
Domain Number 1 Region: 20-170
Classification Level Classification E-value
Superfamily PEBP-like 1.57e-32
Family Prokaryotic PEBP-like proteins 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 267748.MMOB0830
Sequence length 172
Comment (Mycoplasma mobile 163K)
Sequence
MKIKSNNVKNSILHPDFGGYGNKMDKNQAPSHSLHLEWEEVSGAKSYALEMIDYEASGVV
GFPFIHWVVANIKTNSLEEGASLKNQSILQGVNSRTPKGIVPEAFRAPTIELASQYFGPY
PPDQSHDYVIRIYALNVEKLNLAKNFNLADLHRAIKGHVIDKGKFVFTYLKK
Download sequence
Identical sequences Q6KIK7
WP_011264603.1.31918 gi|47458918|ref|YP_015780.1| 267748.MMOB0830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]