SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 269084.syc0371_d from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269084.syc0371_d
Domain Number 1 Region: 37-92
Classification Level Classification E-value
Superfamily Rubredoxin-like 1.31e-20
Family Rubredoxin 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 269084.syc0371_d
Sequence length 138
Comment (Synechococcus elongatus PCC 6301)
Sequence
MDTPEASTPLANTEPEPVEEGTPEAAAETSETKPLVFLDRHECRSCGYIYEPNEGDPRRQ
IAAGTVFEEVPSNWRCPICGSPRSQFRNIGPKGIPSGFSENLGYGLGVNTLTPGQKNLLI
FGALGLAVLFFLSLYGLN
Download sequence
Identical sequences A0A0H3K002 Q8KPP5
WP_011242683.1.45845 WP_011242683.1.5740 WP_011242683.1.95485 gi|81299988|ref|YP_400196.1| gi|56750380|ref|YP_171081.1| 1140.Synpcc7942_1179 269084.syc0371_d

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]