SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 269483.Bcep18194_A4788 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269483.Bcep18194_A4788
Domain Number 1 Region: 143-336
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 6.25e-40
Family N-acetyl transferase, NAT 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 269483.Bcep18194_A4788
Sequence length 344
Comment (Burkholderia 383)
Sequence
MLAEVRPDGFTMLDTYRLAFSDGLFAVRDGAEIRVAQGDGIGAQLLRAQLGDDGALRLVA
YNHRAAPVDQRRALLAALAAAFSDSARHAAIRLDPAAWPAVALDALRASGVLADGGRCMR
EGWAQQADLWLVGPHLPCATLPMFTDGRRHPRRPPAPRGEVYARDLPALGVRFTLRGWQP
AEDSARLARWFDDPRVRDGWPGAQPGADGTQGTAPDADPHVIPLVGCFDGEPFAYVEAFW
LKEDALAPHVAARDYDRGLRMLVGESRWRGPHCVAGWLPSVVHYLFLDDPRTEAVGCAVP
AGHTRVADHLARHGFARQRRLALADAQPLWMRTLRETFFSGRHV
Download sequence
Identical sequences Q39GN3
WP_011351942.1.41686 269483.Bcep18194_A4788 gi|78066258|ref|YP_369027.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]