SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 269484.Ecaj_0375 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269484.Ecaj_0375
Domain Number 1 Region: 541-1033
Classification Level Classification E-value
Superfamily ALDH-like 1.44e-125
Family ALDH-like 0.000000167
Further Details:      
 
Domain Number 2 Region: 184-527
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.22e-106
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000115
Further Details:      
 
Domain Number 3 Region: 13-182
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 1.2e-57
Family N-terminal domain of bifunctional PutA protein 0.0000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 269484.Ecaj_0375
Sequence length 1049
Comment (Ehrlichia canis Jake)
Sequence
MGDIGMISALQAPNEIRKRMQMLYRTEENSYARYLTEKTEVSQDSKIRIYSVAKQIIEKI
RVDRNLGIIDAFMQEYGLSNEEGIALMCLAESLLRIPDDCTINDLIKDKIGNSMWSNHIG
SSSSMFVNAATWGLFIGGIVLKESNDSAKWFGTINNLLKTMGEPIIRKAIQQAMCTLGKH
FIKGRDITEALNNRKEGELYSFDILGEAAKTRKDAERYFSEYMQAVDSIGKSKGSDDTGR
LVDYDEISVKISALHSRYEFSQIDDVLDEIVDKLLQICRLAKEYNIRVCIDAEEASRLEI
SLMILEKLRFESSLNGWEGLGLAVQAYQKRAFSVLDFVEDISVRSCHKMMVRLVKGAYWD
YEIKNSQELGLSSYPVFTRKVYTDVSYLACANKILSKPNTFYPCFATHNAYTLAAILEMA
NKDHPGFEFQRLHGMGASLYEYVTQELAANIKCRVYAPVGGYQDLLPYLIRRLLENGANS
SFINQLNDSNISLEQLIQDPLEKAKELEYLPHPNIPLPKDIFGPERLNSSGIDITDSVTL
ANFNDEMKNYQNCKFKASSIVNGEEFDGDFIEILSPSNSEDLVGEVLFASSTQALSALDI
AYSAFKDWSNVPVSTRASILEKAANLIEENKAKLIMLLIREGGKVISDAIAEIREAVDFL
RYYAVLGRQELEGSNRLPGPVGEDNYLYFRSRGVFVCISPWNFPLAIFIGPIAAALVTGN
TVIAKPAEQTSIIAYEAVKLLYDAGIPKGVLHLLLGDGKELGEVLLKNEKIGGVAFTGST
ETARIINQSIAEKEGGIIPFIAETGGLNTMITDTSALVEQVTNDVITSAFKSAGQRCSAL
RVLFVQEEVADKQIEMICGAMEDLVIGDPMLLKTDIGPVIDKASQEMLIAHADRMSQEGK
LLCQVKLGEECQKGYFFAPCAYEIQNISQLQREVFGPILHIIRYKKGDLHKILSEINDTG
YGLTFAVQSRVQSNIDNIIDNINVGNVYVNRNQVGAVVGVQPFGGQGLSGTGPKAGGPYY
LHRFLTEKVVSINTTALGGNTSLMCLTDQ
Download sequence
Identical sequences Q3YS87
gi|73667000|ref|YP_303016.1| 269484.Ecaj_0375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]