SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 269797.Mbar_A2695 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269797.Mbar_A2695
Domain Number 1 Region: 2-93
Classification Level Classification E-value
Superfamily Transposase IS200-like 1.09e-24
Family Transposase IS200-like 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 269797.Mbar_A2695
Sequence length 93
Comment (Methanosarcina barkeri fusaro)
Sequence
MIDISKKSNFEILEMETDKDHIHLVIKSEPKVSVLSIVRKLKQESTNGLWKTQKEYLEKY
YWGENTLWSDGYFASTIGNVSKEAVEYYIRNQG
Download sequence
Identical sequences A0A0E3LLH6 Q468U3
gi|73670164|ref|YP_306179.1| 269797.Mbar_A2695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]