SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 269798.CHU_1321 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269798.CHU_1321
Domain Number 1 Region: 432-480
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0000000000000616
Family Rubredoxin 0.0022
Further Details:      
 
Domain Number 2 Region: 3-46
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.0000804
Family Duplicated SiR/NiR-like domains 1 and 3 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 269798.CHU_1321
Sequence length 490
Comment (Cytophaga hutchinsonii ATCC 33406)
Sequence
MPKRISVEVYCKGGIISPGTLRKIAMIAQQFGAECLQLGTRQEIRFTIKEIFMADFKIRF
DLLSLSYSIGIHAHFNIVSSCLVKDILQTKVWLTEGEYKDILESFDFQPRIAINITDPDQ
YAMPLFTGVLNFIASTVEGYWNVYFSLPEQKEQGWLPVLIQSEKISSFSMFVQTCIFAQD
KISLNELMEELYLLDTWNFKKVDAYPAIPDYHFFPVEGFHPYGSKHWLGIFNTHNEFSIS
LIDAICVEALESNIGTIYISSWDSFLLKNISTVRIPFWEQLLGLYDVSTGHAAHELNWNM
NEWNMNSNEVRSYVNDYFRVRDKRTEGLILGVNNHPNDTFYSIKVVEEPLFTFLGKNCFP
VYHIRYKENFNPNNPVDVAFMDYVQKKNLPEFISYLTEEYYTAKKARFDKALVTPAPAPV
IVQKSKEAFEFSYQCSVCLTIYDPAYGDADEGIVPGTSFDALPQNYCCSICSNSKKGFNL
FIDTETKHAS
Download sequence
Identical sequences Q11VH3
gi|110637726|ref|YP_677933.1| 269798.CHU_1321 WP_011584708.1.19587 WP_011584708.1.79486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]