SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 269798.CHU_2230 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269798.CHU_2230
Domain Number 1 Region: 8-99
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000612
Family Voltage-gated potassium channels 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 269798.CHU_2230
Sequence length 112
Comment (Cytophaga hutchinsonii ATCC 33406)
Sequence
MLHNKELAPTSVYLWRTFVLFIISFTFLALSLGLGVWGYHYYAGLSFIDSLLNASMILTG
MGPIDPMKTDAAKLFASFYSIYSGVAFLTSIGVFIAPTLHRLLHKFHIEDSE
Download sequence
Identical sequences Q11SX1
269798.CHU_2230 WP_011585610.1.19587 WP_011585610.1.79486 gi|110638626|ref|YP_678835.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]