SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 269798.CHU_2838 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269798.CHU_2838
Domain Number 1 Region: 3-255
Classification Level Classification E-value
Superfamily SPOC domain-like 1.53e-56
Family Ku80 subunit middle domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 269798.CHU_2838
Sequence length 259
Comment (Cytophaga hutchinsonii ATCC 33406)
Sequence
MKTIWTGAIGFGLVNIPVKLFSATHESRLDLDMLDKKDHSNIKFQRVNAKTGKEVAWDNI
VKGYKIEDDYVILDEKDFEKANAKKTKTIEILQFVQEDEIDSVYFETPYYIQPDKSGTRA
YALLREALIKSKKVAVANYVLRNKEALAILKPVGNVIVLNKIRFQEEILDADALDLPAKS
AIKEGEMKMALSLIDQLTETFDISKYKDTYTSELLKLIKAKAKGTVVKTKSAASKPTATK
DLMAQLKASLQPTKRAAAR
Download sequence
Identical sequences Q11R78
269798.CHU_2838 APC62810 gi|110639219|ref|YP_679428.1| WP_011586196.1.19587 WP_011586196.1.79486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]