SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272558.BH1516 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272558.BH1516
Domain Number 1 Region: 63-334
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.81e-76
Family L-arabinose binding protein-like 0.00000338
Further Details:      
 
Domain Number 2 Region: 2-61
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.5e-17
Family GalR/LacI-like bacterial regulator 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272558.BH1516
Sequence length 343
Comment (Bacillus halodurans)
Sequence
MNRPTIKDVAREANVSIATVSRILNKGVGYSEKTKQHVLETIEKMGYHPNAVARGLINKK
TDSIGVLFPNVSGLISAQILQGIEEVAQSHGISVIVCNTASDHKKTMDYLTFLQEKQVDG
LLFISQLLTKDYREFIKKMGVPIITISAFSETNDVPYVKVDDEAASYDAVRYLIEKGHTD
IGMISGPPTDPLAGHPRIQGYKRALREADLPFIETKMTWHKGFYFEDGQVAFQKLLKSHP
SITALFAASDELAISAVSSAYHLGIRVPHQLSVIGYDDTKLAKMSIPPLTTVSQPFEEMG
AQATKKLIDSIQSREPNTSLTMPHRIAERESVKNRMAAPNGHV
Download sequence
Identical sequences Q9KCQ3
gi|15614079|ref|NP_242382.1| 272558.BH1516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]