SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272558.BH3340 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272558.BH3340
Domain Number 1 Region: 16-136
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.26e-25
Family Voltage-gated potassium channels 0.00066
Further Details:      
 
Domain Number 2 Region: 116-251
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.97e-19
Family Potassium channel NAD-binding domain 0.0024
Further Details:      
 
Weak hits

Sequence:  272558.BH3340
Domain Number - Region: 258-335
Classification Level Classification E-value
Superfamily TrkA C-terminal domain-like 0.0628
Family TrkA C-terminal domain-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272558.BH3340
Sequence length 338
Comment (Bacillus halodurans)
Sequence
MVNPLAIKGIVGKTPLLVRLLFIIFVIVFVIGIVIHALEPEAFPTLFDGIWWAIVTISTV
GYGDFVPYTLIGRLLGIVLIMSGVGFMTFYVTTLAATTIKSRNAYLEGKLHMTDKDHHII
IGWNERSRHAIDRLLEANENTTIVLIDETLEELPSTYRRVHFVRGNSTEDAILQQANVRE
AASVLITAKHQGSEFSADSRSILTTLAVKSINPHVYTVVEILTEGQIVNATRAGADEVVE
STALTGAVLTNGLLHHNMSKILDRLLTEGEKKQLFFYPIPEGMIGKTFDDYFQSLYESDE
GLAIGLKRVDRIHLYPPKNMLLLSGDEVALLVRTESHL
Download sequence
Identical sequences A0A0M0KHT7 Q9K7M1
1797M APC64605 gi|15615902|ref|NP_244206.1| 272558.BH3340 WP_010899481.1.28103 WP_010899481.1.91347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]