SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272568.GDI_1306 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272568.GDI_1306
Domain Number 1 Region: 2-232
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 8.63e-33
Family Methylenetetrahydrofolate reductase 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272568.GDI_1306
Sequence length 247
Comment (Gluconacetobacter diazotrophicus PAl 5 FAPERJ)
Sequence
MTRISVELIPRDAEALLRDAAEVRQHFPLADTLNVPSLMRFPLRGWDAVPLLRPVLPRIV
PHIRAIDVDPAGPLPGVDVPGLEEVLVVQGDPPADLGHRTFPNSSESVIRRYRREAPHLR
VYAAFDPYRRAPYHELDAVARKKDAGATGFFTQPVFDPRMLDLCMEWLAGEAVFWGLSPV
IGPKSRSYWETTNHVVFPRDFEPTIEANIAFACRAIRTVRDAGGHVYLMPLRVKLERYLA
PIQQELG
Download sequence
Identical sequences A9HEL4
272568.GDI_1306 WP_012224548.1.42434 WP_012224548.1.67455 gi|162147101|ref|YP_001601562.1| gi|162147101|ref|YP_001601562.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]