SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272568.GDI_2670 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272568.GDI_2670
Domain Number 1 Region: 557-1005
Classification Level Classification E-value
Superfamily ALDH-like 1.11e-121
Family ALDH-like 0.000000426
Further Details:      
 
Domain Number 2 Region: 185-530
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 7.85e-115
Family Proline dehydrohenase domain of bifunctional PutA protein 0.00000000095
Further Details:      
 
Domain Number 3 Region: 16-184
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 3.53e-60
Family N-terminal domain of bifunctional PutA protein 0.00000231
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272568.GDI_2670
Sequence length 1190
Comment (Gluconacetobacter diazotrophicus PAl 5 FAPERJ)
Sequence
MIQPFATLDAAVPARSALRQAITDQTRAPEPACVAALAQAATLPASLSAEVRDTATRLVG
ALRRSGTTGLVQGLIREYDLSTQEGVALMCLAEALLRIPDDATRDALIRDKIGRGQWRGH
VGNDASLFVNAATWGLVFSGTVLSPHQTGGLAGSLSKLVARCGEPVIRRGVDMAMRLMGA
QFVTGQTIETALGNSRRLNARGFRYSYDMLGEAATTAADAARYYREYEHAIHAIGGAAQR
QGVYRGPGISVKLSALHPRYSRLQRQRAMTELLPRLTALARLACCYDIGFNIDAEEADRL
ELSLDLLEALCFDDTLAPWQGLGFVVQAYQKRAPLVLDWVIDLARRSRRRLMIRLVKGAY
WDSEIKRAQVDGLTDFPVFTTKIHTDICYIACARTLLAAPDAVFPQFATHNAQTLATIHA
LAGPDFTDERYEFQCLHGMGEALYTEVVGPEKLNRPVRVYAPVGTHETLLAYLVRRLLEN
GANSSFVNQIQDNGISIAQLTADPVTRLDPTARNAAIRLPADLYAPERQNSRGLDLTDEN
TLRALAAVLPRSGIHDDTDGQPVVNPADHRDIVGRIAFTTPEQVDAAIGRAEDAGAGWSG
TPPSVRAAILARAADALEADMPRLLGLIVREAGRSLPNAVAEVREAVDFLRYYGAQVAGS
FRNETHRPLGPVACISPWNFPLAIFVGQVSAALAAGNTVLAKPAEETPLIARAAVRILHA
AGVPPDALHLLPGAGDVGARLVGDRRVRGVVFTGSTDVARLIQRQLAARLNPDGTPVPLI
AETGGQNALVVDSSALPEQVVADVLSSAFDSAGQRCSALRVLCLQDDGAERILTMLRGAM
DELSVGNPDRLATDIGPVISAEAQARITAHIDTLRARGYRIHQAPLPPDCTHGTFVAPTI
IEIPDIAVLDREIFGPVLHVVRFARKDMARVLRDINATGYALTFGVHSRIDDTIAALTSR
AQAGNIYVNRNLVGAVVGVQPFGGHGLSGIGPKAGGPLYLRRLLSRCPVLDGAFARPVPE
PARLCRNWLHSAPPAGDGPGCPATPLGTTITLPGPVGEENIYSLTPRGTVLCAGPTPQAV
ARQAEAALATGNRAVVPAALLAVLPPLPAGLSSRIGAFRDPDIIDVALCDGTEGDRTALG
MNLAGRTGPIVGLHTPGPDGGYALEWLVLERSCSTNTTAAGGNAALMAAG
Download sequence
Identical sequences A9HPN9
WP_012226756.1.42434 272568.GDI_2670 gi|162148451|ref|YP_001602912.1| gi|162148451|ref|YP_001602912.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]