SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272623.L111484 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272623.L111484
Domain Number 1 Region: 3-197
Classification Level Classification E-value
Superfamily ITPase-like 1.54e-62
Family ITPase (Ham1) 0.00001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 272623.L111484
Sequence length 201
Comment (Lactococcus lactis)
Sequence
MEKTLIIATRNSGKTKEFKKLFADFGYEIKDLTDYPELSEIEETGTTFEENARLKAEQIA
EITGQVVIGDDSGLCVDVLGGLPGIWSHRFSAPDPTDEKNIAKLLHELAPTAITPERRSA
HFHTTLVAAKPGRESLVVEADWDGYIALAPKGENGFGYDPIFMVDAFRTAAELSEKEKNQ
VSHRGQALRKLMAELPEWLYK
Download sequence
Identical sequences Q9CG29
272623.L111484 gi|15673263|ref|NP_267437.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]