SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272632.MSC_0141 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272632.MSC_0141
Domain Number 1 Region: 37-118
Classification Level Classification E-value
Superfamily TrpR-like 5.23e-16
Family Chromosomal replication initiation factor DnaA C-terminal domain IV 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272632.MSC_0141
Sequence length 180
Comment (Mycoplasma mycoides)
Sequence
MSKLNLEKKLKIVKEAKKLNIKKSTYLANKYDISVDTVESLVNRFEVFGIEGLINKEKKP
YYSAKLKLKIVLYKLETNHSYDEVAKKFNIIYSSTIAGWVKKYREYGFLGLNNNIGRPKK
IMKNPNKKPAKIKKSQVKINNEQQIKELKEQVEYYKLEAEFWKKFHTLLTKEKSTRKKQK
Download sequence
Identical sequences A0A126SSV3 Q6MU97
gi|42560694|ref|NP_975145.1| 272632.MSC_0141 NP_975145.1.55851 WP_011166344.1.11018 WP_011166344.1.3214 WP_011166344.1.37196 WP_011166344.1.51345 WP_011166344.1.84266 gi|479184340|ref|YP_007810938.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]