SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272843.PM1765 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272843.PM1765
Domain Number 1 Region: 4-153
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 7.9e-36
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.0078
Further Details:      
 
Domain Number 2 Region: 127-275
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 3.6e-24
Family Glucose 6-phosphate dehydrogenase-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 272843.PM1765
Sequence length 359
Comment (Pasteurella multocida)
Sequence
MSNIKIALIGCGFFGQQLALGFTKAGADLLGVTDLSMEFAERLAAKFNTKAYSDMETLFH
EVTPDLVLIATPNYAHKVPALTALKHGCHIFIETPFSIHQTDCSEILTLAKQKKKSVFIG
HLLRTLPGLLKAKELMMQNVLGKITVARASRQRWIDAFQDKNWWKNDVNLTGGKLFNEIH
ELDLLCWLLGDVSSVYAQATNRAHTDTPDNHDIIQLLLQFESGVFASLEMGTAYRLHEWG
ITIHGELGALMVNFFTSTMTLSFADGTRQQFNLYDEFEADLSLRESGKATQKYNLPTALS
PLWLTRAVEIEADMVVKHLLGVTEHCILSQATTKAIAVACAAKKSIETQQRVELDTASM
Download sequence
Identical sequences Q9CK69
WP_005724730.1.12311 WP_005724730.1.15732 WP_005724730.1.19996 WP_005724730.1.40210 WP_005724730.1.45422 WP_005724730.1.4808 WP_005724730.1.53852 WP_005724730.1.6219 WP_005724730.1.62389 WP_005724730.1.66990 WP_005724730.1.70689 WP_005724730.1.81885 WP_005724730.1.8281 WP_005724730.1.89773 WP_005724730.1.9746 gi|15603630|ref|NP_246704.1| 272843.PM1765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]