SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 272843.PM1948 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272843.PM1948
Domain Number 1 Region: 152-377
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 0.0000000000109
Family Lambda integrase-like, catalytic core 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 272843.PM1948
Sequence length 506
Comment (Pasteurella multocida)
Sequence
MNQNKRLRQSRDGYVFDENENSWHISKDKTINFSQPILNINKKTLDGFRKTLAIYAEKYS
SYHVYHMYQQFQRLVISTNLEVINVPIILDWKNKLGKEHEWYLGALKGFLLSWHEYGYYG
VDKSVVSLLESFTLSGNDKGKSVLMRCPYTGAFTENEILALMAELARLWREDLISFETYA
YIHLLQSTARRPIQIRHLKFEDLRKEISQGTWNYFLNIPSAKKRGGLFRETFKKLAITED
LYLILLNFMEYQYKKLLSLVDETFISSYKMKLPMFIDWNCLKKNIKNRNFDLSLLNKDIF
HYSASSLELYALRKFCIHQKAISERTGEIIHVTARRFRHTRGTNLGRKGVGATIIAELLD
HTDTQNVKVYTENTADTVQYIDRVMGAEMGKLAQAFTGRIISNLNESERGHDPTSLITNN
GIDTIGACGTNDFCITGYETCYLCPKFRPLVDGPHQQILNKLYEEKEERLKQTKSIDYAS
SKDRIILAVEYVVQACNDMKRTIGSH
Download sequence
Identical sequences Q9CJP6
gi|15603813|ref|NP_246887.1| 272843.PM1948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]