SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 273057.SSO2006 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273057.SSO2006
Domain Number 1 Region: 12-123
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000134
Family Cgl2762-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 273057.SSO2006
Sequence length 157
Comment (Sulfolobus solfataricus)
Sequence
MVQAYEEEKDARIKERILSVKLHLVDGKSEKKVSKMLNKGYSTIKLWVGKYKKEGLNGLR
DKPRSGRPRKAEKGKIKQILEDQPQKYGIQEEYWTMRTFKIALQEQGIEYKKSRLYELVH
ELGYNLVKPRPTNVQAKKDMWDDFKIGRRGSLLSRRE
Download sequence
Identical sequences A0A157T4A0 Q97WV6
gi|15898799|ref|NP_343404.1| WP_010923718.1.8449 273057.SSO2006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]