SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 273057.SSO2949 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273057.SSO2949
Domain Number 1 Region: 6-126
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000161
Family Cgl2762-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 273057.SSO2949
Sequence length 150
Comment (Sulfolobus solfataricus)
Sequence
MQDLVQAYKEEKNARIKERILAVKLHVVDGKSEKEVSKMLNKGYSTIKLWIGKYKKEGLD
GLKDKPRSGRPRKVEEEKIKQILEDKPQKYGIQQEYWTMKTLKIALQEQGIEYKKSRLYE
LVHELGYNLVKPRPTNIQAEKDKWEDFKKK
Download sequence
Identical sequences A0A157T2E4 Q97TW2
273057.SSO1719 273057.SSO2927 273057.SSO2949 WP_010923679.1.8449 gi|15898526|ref|NP_343131.1| gi|15899638|ref|NP_344243.1| gi|15899656|ref|NP_344261.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]