SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 273063.ST2572 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273063.ST2572
Domain Number 1 Region: 106-372
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 7.47e-80
Family D-glucarate dehydratase-like 0.0000141
Further Details:      
 
Domain Number 2 Region: 3-123
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 9.09e-23
Family Enolase N-terminal domain-like 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 273063.ST2572
Sequence length 392
Comment (Sulfolobus tokodaii)
Sequence
MTKISDVEAILLGKEITSAKWASLMVLVRVVTTDGRIGYGETVTALRANAVVDLVKKINK
VMKGKDVFDLEKNKMEWYKQDFNMSISLESTTAYSAFDIASWDIIGKEFGVPIYKLLGGK
YRDRIKLYANGWYQNAVTPEDFAEKAKEVVKRGYKALKFDPFGSYFHFIDKKGLKEAEER
VKAVREAVGDDVDILIEHHGRFNVDSAIEIAKILEKYNPLFVEEPVHPEDVEGLRKYRSF
TKLKIALGERIITKTQALEFMKEGLVDYLQIDLYRIGGVTEAKKVVGIAEAFDVLMAFHN
AQGPILNAVTLQLDTVIPNFLIQESFYEWFPSWKRELIRDSTPVENGEALVPEKPGIGVD
FNEKMIEELRVKEEVFEPGEPLWVVKGTWKDY
Download sequence
Identical sequences Q96XE5
gi|15922905|ref|NP_378574.1| WP_010980657.1.60790 273063.ST2572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]