SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 273063.STS142 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273063.STS142
Domain Number 1 Region: 5-88
Classification Level Classification E-value
Superfamily AlbA-like 6.15e-25
Family DNA-binding protein AlbA 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 273063.STS142
Sequence length 90
Comment (Sulfolobus tokodaii)
Sequence
MTVKKPNEILISRTKRVEDYVLDVIVMFNQGYDEVELKGVGNSIYKAVEVYNQLKDRLGD
GIILEKADIGSEVKDRRRISYISIKLKRVY
Download sequence
Identical sequences Q971T6
gi|15921556|ref|NP_377225.1| 273063.STS142 WP_010979312.1.60790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]