SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 273068.TTE2632 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273068.TTE2632
Domain Number 1 Region: 7-122
Classification Level Classification E-value
Superfamily AF1862-like 1.28e-30
Family Cas Cmr5-like 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 273068.TTE2632
Sequence length 135
Comment (Thermoanaerobacter tengcongensis)
Sequence
MVEGLKVKTLEQERASFCLKEIEELPKGKDKRDKYKTNARRLPAFIVSNGLIPTLAFYKS
KEETKPVYDTLNKWLQKRGYISENKDALDELVDKDFQILRLATTEILALANWLKRTVEIE
IKEEKDDLSGEREEQ
Download sequence
Identical sequences Q8R6Z8
WP_011026627.1.99938 gi|20808977|ref|NP_624148.1| 273068.TTE2632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]