SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 273116.TVN0320 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273116.TVN0320
Domain Number 1 Region: 5-159
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0000000000000986
Family GHMP Kinase, N-terminal domain 0.0075
Further Details:      
 
Domain Number 2 Region: 194-303
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00000288
Family Mevalonate 5-diphosphate decarboxylase 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 273116.TVN0320
Sequence length 320
Comment (Thermoplasma volcanium)
Sequence
MSNSSITSVAYPTIGVVLLGGIANEKTRTPLHTSAGIAYTDSCGSIRTESTIYGDSEMHI
YFNGTESKDENRSVKSVLERYRNELQSFFGKKDVSYSSLNYGILSGSSDAGAASIGAILS
FIDKKNDIHDIENDIRMISESAGRSLHGGLTITWSDGYSAYTERVLGPEHFNNYAIVGFS
FDYPRNPSDTIHQNIIKSKRYKQRTIDADEHAHEIKEMARTDDIEGIFEKAEEDTEEYHS
ILREVGVLVIRENMQKLIEFIKILRKEFWNSYIVTGGSNVYVIVRRDDLERLIHIKNTFG
SKPKILNVAGPAWIKKVESD
Download sequence
Identical sequences Q97BY2
gi|13541151|ref|NP_110839.1| WP_010916578.1.10044 273116.TVN0320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]