SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 273116.TVN0731 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273116.TVN0731
Domain Number 1 Region: 181-513
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 4.76e-50
Family N-acylglucosamine (NAG) epimerase 0.049
Further Details:      
 
Domain Number 2 Region: 2-127
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.52e-27
Family Thioltransferase 0.06
Further Details:      
 
Domain Number 3 Region: 479-579
Classification Level Classification E-value
Superfamily Seven-hairpin glycosidases 0.0000327
Family Class I alpha-1;2-mannosidase, catalytic domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 273116.TVN0731
Sequence length 647
Comment (Thermoplasma volcanium)
Sequence
MANELVHEKSPYLLMHSNDPIDWMPWSERAFSKAAAENRLIFLSIGYSTCHWCHVIHDES
FSDKDVADILNKNYVCIKVDREERPDLDSYFMNVSAVINGSGGWPLNVILLPDRRPVFAF
TYVPKEDRRGMTGLKTLAQQIALIWKNDPQQFESQAVAVMDAVKNRMPGRAKINVDVFSK
LELSLRTSFDLQDGGFSGSPKFFNTPALNYLLERFYETGNEEILNFIGLTLKTISIRGIH
DLVNGGFFRYSTDTMWIVPHFEKMLYTQTQLMKLFSKMFMLTRDNVYRDMIYDIKRFMDE
NLYWPGHGYYSGMDADVDGNEGGYYKWSFQDLKVALGQDFEAFRAIFDISEGGNYMDELY
GQTGDNLIYFTGSFDEYRRSIEENGSTDMLSRSIEKLREAEKKRKKPSVDKKILTDLNGL
AISSLSWAYRATGDKEFLDSAVSVSEFIIKNMIGDYLLHSFFEGSASVKSSLFDYAFLIR
GLIDLYTITFDQKYLEEAKKLADEAIKFLFDGKFKLSEEIDDPQIADSEVESPYATIVAD
LDDLSLLTEDLQYHQIADQALTSVFDAVSRFPSAFPSMVISAEKHIYGKVVSCRANKVRE
AESIIPSEIALFSQLESEKYNICTYFACLNPVESIDVLKRSIYKLAD
Download sequence
Identical sequences Q97AR7
gi|13541562|ref|NP_111250.1| TvR79 WP_010916989.1.10044 273116.TVN0731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]