SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281090.Lxx06190 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281090.Lxx06190
Domain Number 1 Region: 1-290
Classification Level Classification E-value
Superfamily Phase 1 flagellin 1.44e-50
Family Phase 1 flagellin 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281090.Lxx06190
Sequence length 290
Comment (Leifsonia xyli xyli CTCB0)
Sequence
MTMRVTSTAQLLTTQRNLQAAKASMNDLYQEGTRGVKIAKPSDDPAGVANLLTVRKQLSQ
NAQHTSNVDDGIGWMKTVDSALTGSADVISKIRDLVVQAANTGTSSPANQDSIVKSIEQL
KQNLLALANTQYLGRSVFAGTSDADTAFDVKSYAFNGTPGAEVSRRVSPSATIPVSADGA
AVFGTGSGSVFSLIDGIATKIAADRNVGSELAAIDSALNTISGAQAAIGTNFAQLQLGTD
ATTLEEARSRIEDADPADVVLRLNAQQVSYQTALAVAAKSIQKTLMDYLR
Download sequence
Identical sequences A0A1E2SKE9 Q6AGB7
WP_011185577.1.68452 WP_011185577.1.84704 gi|50954395|ref|YP_061683.1| 281090.Lxx06190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]