SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281090.Lxx17070 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281090.Lxx17070
Domain Number 1 Region: 2-60
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 0.0000000000000327
Family ADP-ribosylglycohydrolase 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281090.Lxx17070
Sequence length 93
Comment (Leifsonia xyli xyli CTCB0)
Sequence
MPIALGMLIAAEGGYREAVLGSINYGRDSDSIAVMAGSIAGALGGLAAVPGEWIDGVNEG
SRSVARDVWAADAARAADVAALRTGFAVSLEVA
Download sequence
Identical sequences Q6ADS7
281090.Lxx17070 gi|50955286|ref|YP_062574.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]