SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA02901 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA02901
Domain Number 1 Region: 13-359
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.67e-49
Family FAD/NAD-linked reductases, N-terminal and central domains 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA02901
Sequence length 400
Comment (Caenorhabditis japonica)
Sequence
MSFPISRRCFSKQSYDAIIIGGGHNGLTAAAYLAKAGKKVCVLERRHVLGGAAVTEEIVP
GFRFSRASYLLSLLRPVVMQELSLKKFGLKYHIRNPNSFTPIRDSKQSLLLGMDMAENQK
EIAKFSQRDAENYPKYEHFISEIVHAFEPLMDYEPIDLQKSIPKLLPHLYLLFKTVQPLG
LKNAVDFYELMTAPISKIMNKWFESDVLKATLGTDGVIGLAASPMDPGTGYVLLHHVIGG
LDEHKGAWGYVYGGMGAVSNAIAECAKSHGAEIYTEQEVKEVILDGNVAKGVRLANGKEI
YAKIVMSNATPHVTFNQLVNKDSLPSDLHRAINQIDYTSPVTKINVAVKELPNFLARPNQ
GSDPMPHHQTTIHMNCENMQVVHDAVIDYKNGRYSRRWEF
Download sequence
Identical sequences CJA02901 281687.CJA02901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]