SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA04959 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA04959
Domain Number 1 Region: 152-467
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.12e-38
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0056
Further Details:      
 
Domain Number 2 Region: 25-112
Classification Level Classification E-value
Superfamily ISP domain 8.12e-22
Family Rieske iron-sulfur protein (ISP) 0.0093
Further Details:      
 
Domain Number 3 Region: 470-553
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000000000137
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA04959
Sequence length 564
Comment (Caenorhabditis japonica)
Sequence
MPLCSYPPEEPECENDDSPLVEEAIANIEDVPPGTKKTFEVRGRKILVINDEGRLLAING
LCSHYNFPLENGIYAKGRIRCPLHGACFNVRTGDIEDYPGFDSLHSYQVCIVHYSGALNT
KIQVSNQNGKIGIKTTEKKLGSDRKVRALPKMKKCDDRPVVVIGGGIAASTFIEHSRLNG
LVTPIVVISEESFPPYDRVLLSKNPSATGENIRLRKDDAFYEERNVKFHLKTSVTEVKPN
SREVYLSNGDVIVYSKLVIATGGNVRKLQVPGADLKNIFYVRKVEDANTIASLHPGKNVV
CVGSSFIGMEIASSLTANAASVTVISNSAEPLPVFGEDIGRGMRRKFEEKGVRFELATNV
VSLRGNFDGEVDKVILSNGKELDVDLLVCGIGVTPATEFLKGSGIALDNRGFIVVDEKFR
TNISYIFAIGDAVTAPLPLWDIESINIQHFQTAQTHGQYLGYTIVGKPQPGPIVPYFWTL
FFFAFGLKFSGCNQGSTKEYTHGDPEAGDFTRYFLKKDKVIAVASGGPTSAPAQFAEIFK
KGIEVTLKDLKNSKDHQWTHLLQQ
Download sequence
Identical sequences CJA04959 281687.CJA04959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]