SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA05078 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA05078
Domain Number 1 Region: 377-521
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 9.01e-43
Family Reverse transcriptase 0.0011
Further Details:      
 
Domain Number 2 Region: 82-115
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000593
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 
Weak hits

Sequence:  281687.CJA05078
Domain Number - Region: 143-240
Classification Level Classification E-value
Superfamily Acid proteases 0.000325
Family Retroviral protease (retropepsin) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA05078
Sequence length 528
Comment (Caenorhabditis japonica)
Sequence
MDEFVETMDGVLELGVEDRATGAAAATIGESTTGTAEEELLREMDMHRMAEENVERLKKA
LRRREKWPRETRATSSIALRSREGKPHREGGFFNPNRKCFRCGGMGHMSRQCTSKPVQNV
KAREEDAVKSVGAEIVEIVEMLGQRRRIVIDSGAVVSVMSTGAWNSLKKGCPSWEKEVEM
LEKPSFTLVDASKMNMPVKEQVKIDIGVRGRRALVVFQLVENEADIFLLGTNAFGSVGVE
LKWKAERSVALAAEKLRVPPQSCAQIMVKVEADLGNNVLLESKEEWVPTSLCSKNENGNL
TVLVSNWKDEPLLIKKNHVIGVVTREWELLESKRNKAVNMLDLKRKVPLKGNRRNDEVWR
ILVENGEVPDGNIRRIASEFIDVFAIEDSELTQTDKVQCEIELEKENPIRQKCRPVPLAL
QEKVKVMLEDMETRKVIRKCRSPWASPVVLVKKKDGSIRMCVDYRKLNTVIKLNAHPLPH
IESTLQALGEKKWFTTLDLMAGYWQIPMEKQSKEKTAFVVLMSSTSLK
Download sequence
Identical sequences 281687.CJA05078 CJA05078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]