SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA09010 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA09010
Domain Number 1 Region: 216-361
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.94e-25
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000881
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA09010
Sequence length 390
Comment (Caenorhabditis japonica)
Sequence
MLLRAVGRQMSAALRQKTAIRSIALSRMALGGGHHHHEPQPVYIPKPGSLDWSLFGSPVK
SKHEFEPYKPEVGAFIGAAVFIGLTIAAVVFKTDTFKKDKHHGHHEKKHAPKEEEAHHEV
EEKHVEPESAPVEEPVKVEEPVKEEEATPSTSDAAQEAPAPVADEPAAAPAPSTSTEQEQ
KTPEPEEPAPSTSSSEEKTTAEPASSEETKEEKSPNLHCEYVIIGSGTAAYYASLAIRAK
HAEAKVLLIGDETELPYNRPPLSKELWWYGDDSAVEKLDYTSLSGKKRDIFYEVDGFFVT
PEDLPKAVHGGVSLLKGQKAVKICAEDKKVVLEDGTTVGYDKVLIATGVRPKKEKVFEEA
SDEAKEKITYYHYVSFWLFLKYSEKNIGKI
Download sequence
Identical sequences 281687.CJA09010 CJA09010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]