SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA20098 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA20098
Domain Number 1 Region: 30-314
Classification Level Classification E-value
Superfamily NadA-like 5.36e-104
Family NadA-like 0.000000793
Further Details:      
 
Domain Number 2 Region: 310-553
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.54e-41
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.0000835
Further Details:      
 
Domain Number 3 Region: 527-638
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 4.34e-34
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA20098
Sequence length 646
Comment (Caenorhabditis japonica)
Sequence
MNEFVSVSKLYDRVASVLPKAEWMGFEDDVAAILELKRKRNAVILAHNYQTPEIFHCVAD
IVGDSLALARKAIDVEADVIVLAGVHFMAETAKLLNPKKTVLIPDMGAGCSLADSITPQD
VALLREAHPGVPIITYVNTSAAVKAASDICCTSGNAKKVVESLGVPRVLMIPDEYLAQNI
ARETHVEILAWHGHCEVHERFTPDDIRELRESHPGVMVLAHPECPPEVVEAADFAGSTAV
MSDFVGEKKPQRVVLLTECSMSDNVAVDHPEVEFIRPCNLCPHMKRITLANIRQALEENR
HEVTVDAAVADTAPVIVIGSGLAGLMTALTLAPQPVLLVTAGTFAFDGSSALAQGGIAAS
LGDDDSPALHLADTLAAGAGLCDAAVAKNIIEAAAEAIATLEDYGVRFDSKPGGSYALGL
EAAHSRHRIVHVDGDATGAGIMRVLAAKVRATQSITIKENTRALRLIKQDGRVAGVELEG
IGPIAGRAVVLATGGAGGLYEATTTPLGNLGQGAALAGRAGAMLADMEFVQFHPTALAVS
ASRLPLISEAVRGEGAILVNDRDERFMRDIPGQELAARDIVARAIGRQLAQGHKVFLDAR
ASLDKGFAKRFPGIDALCKQYGIDPSCDLMPVRPATHYHIGGRGYR
Download sequence
Identical sequences CJA20098 281687.CJA20098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]