SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA20419 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA20419
Domain Number 1 Region: 2-333
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.77e-33
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA20419
Sequence length 424
Comment (Caenorhabditis japonica)
Sequence
MNGPDTPHILVVGAGFGGLQFIHDLKGANVRITLVDQRNHHLFQPLLYQVATTILATSEI
AWPIRHLFRDRKEVTTLLGTVVGVDAAAQKVRLENGEEITYDTLVLATGARHAYFGNDRW
EKVAPGLKALEDATTIRRRLLLAFERAERETDPAKQQALLTFSVVGGGPTGVELAGIIAE
LAKQTMWPEFRNIDTRQARILLVEAGPRILAAFPEDLSNYAQSALEKIGVEVRLGVPVKE
ITEDGVTVGEEFIPCKTAIWAAGVAASPAAAWLGAESDRAGRVRVLPDLTVVGHENIFVI
GDTALVEGPDGKPVPGIAPAAKQQGAYVAKVIRSRTSGKAIPAPFRYRHQGNLATIGRGA
AVVDMGRIKLKGAIAWWVWGIAHIFFLIGTRSRAAVAWSWLWTFISGQHSARLITQGKAA
EDNK
Download sequence
Identical sequences CJA20419 281687.CJA20419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]