SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA20515 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA20515
Domain Number 1 Region: 12-179,269-385
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.92e-50
Family FAD-linked reductases, N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA20515
Sequence length 414
Comment (Caenorhabditis japonica)
Sequence
MNDVVVDKPLTEIVISGGGPAGMMAALALSAKGYRTALLGPETDKNDRRTTALMMPAIRF
LEEIGVWGDIAPEAAPLASMRIVDATHRLIRSPAVTFRAGEIDEVAFGYNIPNAALNQKL
AEAVEKNSAIERITLPAIEYRNNDDHVTITLKGGDTLHTRLVVAADGRNSAAREAAGIRT
RRWSYPQTAVVLSFSHTVDHENISTEFHTEEGPFTQVPLKGKRSSLVWVVNPGRAETLLA
LDDETLGQRIEEMMQSMLGKVTLDIRPQAWPLSGLVPHAFAAKRTVLIGEAAHVFPPIGA
QGLNLGTRDVETLVKAITSDPSDPGSDRVTRAYDRGRRPDILARTGSVDALNRSLLSPML
PAQIARGVGLEMLRSFAPLRAFFMREGLRPGSGFSQFMPKLPSLAERGKTSPKQ
Download sequence
Identical sequences WP_024900263.1.22424 CJA20515 281687.CJA20515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]