SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA20520 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA20520
Domain Number 1 Region: 37-267,307-366
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.11e-35
Family FAD/NAD-linked reductases, N-terminal and central domains 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA20520
Sequence length 559
Comment (Caenorhabditis japonica)
Sequence
MLNLRSRRADKDRARMIRTEPLRLIRSEQEDRLATETYDILIVGGGVTGAYCAFDASLRG
FRVALVEKDDFASGTSSKSSKMVHGGLRYIEQGNLGLVRHSLLERQRLRRNAGHLVQRLP
FLFPILERDGVFDARFAKAFEGLLWTYDLAGGWREGILHQKLTAAEVLAHCPTFKDEYLR
GGLMYFDARVDDARLTLALARSAGFHGATVLNHSKVAELTRSSGRVDGAIIHTVEGKEIR
VRAKTVIMATGVWLRDWMGLGKDGEKPLHVRPAKGVHVAIPWLKIRNDCTVTVPVPGRSR
RATITRWGNVSYLGTTDEDYQGDLDDVHCTRRELDFLIEGACSALNIDLTPDDVVGSIAG
CRPLVAASSGGSTMDVKRDHSVHVAPDGLVTIVGGKLTTSRHMAEQTVDAAAKVLGDRRR
CTTKKAFLLGAAGYDAQAIVASGGMEAHLGERYGTESRFVSDLMAARPELAEPLIDGLPY
TAGEVVYAARHELARTIDDVLSRRMRARLMARDASARAAAKVGALLGEELGLPQTEIDRQ
VAAYVAATEKEKSILIGAN
Download sequence
Identical sequences 281687.CJA20520 CJA20520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]