SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA23673 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA23673
Domain Number 1 Region: 78-137
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.19e-16
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.0027
Further Details:      
 
Domain Number 2 Region: 14-79
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.0000000000000239
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.0015
Further Details:      
 
Domain Number 3 Region: 159-223
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00000000000497
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA23673
Sequence length 251
Comment (Caenorhabditis japonica)
Sequence
MIATSASCRDIPGQELAARDIVARAIGRQLAQGHKVFLDARASLDKGFAKRFPGIDALCK
QYGIDPSCDLMPVRPATHYHMGGVATDSDGRTNLPGLWAVGEAASTGLHGANRLASNSLL
EAAVMGLRAGRAIASIPHAATLPLASKAKSSSSSLPYVRSIVSRHLGLLRDDEGLRSAIT
ALLPLAQTDDAAAAALIMSVAAFERCETRGSHARTDFPGKADATERSFYTFEQVFALARE
VALPEPLSRIA
Download sequence
Identical sequences 281687.CJA23673 CJA23673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]