SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA24564 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA24564
Domain Number 1 Region: 10-212,366-428
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.89e-36
Family FAD-linked reductases, N-terminal domain 0.033
Further Details:      
 
Weak hits

Sequence:  281687.CJA24564
Domain Number - Region: 293-357
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.000942
Family GMC oxidoreductases 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA24564
Sequence length 429
Comment (Caenorhabditis japonica)
Sequence
MIPNDFRLKSLYGHGRDWPVSYDELEPFYARAETELGVSGVDGQDESGKGGSAYPARSIP
YPMRGLKPSYMFDQLSEKLSKGGFNPILEPNGRATRPYGQRPPCGGNNNCNPVCPIAAKY
DGSMHIDEAERHGAIIQDNSVVCKIDADDSGKITAIWYKRPDGSEHKLTARYFVMAAYGI
ESPKIMLLSKSDRFPNGIANSSDQVGRNLMDHTGISMNVMAKEDFWPGEGPTQLLVYLNQ
RDGEFRKNYPSYKIKVRNTVPTGQTTSSLISKGVLGSKLDAEIRRYSARSLNWAVDFETL
PLAENRVLPSTNKVDALGIPVPSIYYSVTDYWNAGRDRALQDFDQIAKLLDAEIVGTDVK
WQNRQHIMGTTIMGDDPKNSVVDRDCRTHDHRNMFIAGTSVMPSSSCVNPTLTGAALSVR
IADTLLREI
Download sequence
Identical sequences CJA24564 281687.CJA24564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]