SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000013973 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000013973
Domain Number 1 Region: 764-891
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000000000038
Family cAMP-binding domain 0.024
Further Details:      
 
Domain Number 2 Region: 513-626
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000267
Family Voltage-gated potassium channels 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000013973
Sequence length 1000
Comment (Anolis carolinensis)
Sequence
FTPVIIFTASFEMDFYIFRKSFWQVLVLAVPGFLMNCGFLGWLTFKINKYNWSWDDSMLF
GIILSTTDPILSVAAVKNIGLSKIVTNLIKGESLFNDATTVIIFELYRDLVHQSHQEVEI
FVQLILKFFASIAFGFLSSKLVSYWLAHIFNDGIIEVILSFSMAYVIFFLAEWFGMSGVI
SLCMLGLLLDSVSFSPGMDAFLYKFWAMLTFLAHIMIYLIMGIVIAQKTFPYINTRGFFS
VITVYLSLNLVRALVILTLSPFLSRLGYGFNWRWGAVLVWSGMRGTFTLNMALALSQTPS
ITAADLQVKTMILLHCGTASLLTLIINSTTVKKLVVTLGLCNITLPKRMAMHNAVQRIRQ
MEANAFSMLKLDRFLADANWTMAEDSMTIEYPYKYVHSDQSVQKTTSRTLPKYPSRVAFC
SWQIASYQKQYNSGMLNQEAAQTLIGAAESYVDIEGKFMNIHEVKTYWESKGMLVTMKKW
LSDWVYNVKDETTKAPKNKFLRLCHQIVFMEEFEYISTMITYLNSVPIILNFITSVNAEY
LPQLKMCNYYFLCLYIGEAALKALAMGRTYIYYHWNQFDLIVIVVGIIDVMIINLFKNMT
PSYPMINTIRIFRFGRLLRVFRLFKLTLPTLIFVLDKQINKQLTFRYDIAKGYVQGEEDI
KRLIEQISGHEKVYIEITKILEKNKQEAMKELGLMQRDYPEIVTAVKTRQAVQTVLNTAS
ETLKFMISGGIVDRNEGAELHKVILVKKKHLAKLPPTIAPPTAQQLLHNVMWLQDNKNQI
EFIQKKAKILYYDYGDIICEEGELPQGIHLIVSGMIKVRSIDKDVMKEGAKKTTHGHTAA
SSYTDYMVTGAIIGELNCLTKQEMEYAVSCETAVQTCFISIDDLLEAFDRFLEPPSLEYK
IWLKIALDIALKTYKENLPNQDWSYKLCAQYSNMYVVDVLNHTKCDIYDEAMDDVILVHG
TVQDCQLGQRYCAPCILPKTCHQVQGTSPATKLLIIRSIE
Download sequence
Identical sequences 28377.ENSACAP00000013973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]