SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2850.JGI45213 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  2850.JGI45213
Domain Number - Region: 490-505
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0398
Family Retrovirus zinc finger-like domains 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2850.JGI45213
Sequence length 648
Comment (Phaeodactylum tricornutum)
Sequence
MMTLTPSNLSSFPGGNQTMETTTKSSAARPSMFRKSLSVRSLSSQSNALVKQKGAFTVQR
SKRIEPSSEVNRIGISEQGFSCQRETEKRPVTRPPDYEGSLVGNKTTTSRRSFLRMNMYA
HSQSATNLIPKEKSFQRSSSCRSVVSKQTKSSDCVMKAKLRSTRGTYGTGEQQNSIGKQS
KGDVRNAFKTMLDRPSHLQGDSGLPKSTALAMPAILIETSDVGEEGTDLGDSFFQCVGNE
GSTKDCMERESRYSTVAPVTAFSDHNKPIPETKMRKMLKKALSINWTRNLAPKQQGPAED
EKNTEAAHANPNSESRKKCPPQTSTSRRPHLRKSSSIRARKEKSFAAIILGNEELSTKPS
QLFPSKPRSLTQRRQHQNQSDARRQVSVNSGYDSFKKLPSTPHLTSFRESDLTLPVSDRM
GSKLSESGKTKPSREPSTDDLLQITPAGEARTALMRRPKGKRFFQLNQMPNESDLCTTSR
TGGVHVNIEVICQLCDQEGHSAKHCFLLHPFKAKPMGPATVSDLHVEAENATPEILRFAA
EDAVKNQQSADTKTSRGRTKRKTRHLGQPLPGYDSPPQMSVELGILQQGLKKESSERPDS
EKLSLGKDIVYQPVHESDTTVFLTPPLRRPTGEHLSEMYEWQQAFLPR
Download sequence
Identical sequences B7FWV2
jgi|Phatr2|45213|estExt_fgenesh1_pg.C_chr_60219 XP_002179445.1.39622 2850.JGI45213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]