SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2850.JGI46889 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  2850.JGI46889
Domain Number - Region: 6-52
Classification Level Classification E-value
Superfamily GIY-YIG endonuclease 0.000497
Family GIY-YIG endonuclease 0.014
Further Details:      
 
Domain Number - Region: 290-326
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000508
Family Retrovirus zinc finger-like domains 0.0055
Further Details:      
 
Domain Number - Region: 96-131
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000912
Family Retrovirus zinc finger-like domains 0.0056
Further Details:      
 
Domain Number - Region: 152-181
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0568
Family Retrovirus zinc finger-like domains 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2850.JGI46889
Sequence length 336
Comment (Phaeodactylum tricornutum)
Sequence
MPNSYTIYTLSLEGGCYYVGSTSRTMSERFQEHQAGTGSSWTRLHPPIKIRKSYRYHGPS
PGLEEDREVYELMKDVGIDKVRGGQFVQLIFTEETKRSLQRTLRHSVGACMRCGRQGHVI
LACRAVTDLYGTVIPRPSETNRSTHKSEVRSTVTQKPRARTVNSKTCARCGRSSHDENRC
YATTHSSGRVLESEENEMEPMPRRAVAQKPRARKVDSKTCARCGRSTHDESRCYATTHSS
GRVLESEEDEMEPMPRRAVAQKPRARTVNSKTCARCGRSTHDESRCYATTHSSGRVLESE
EDESDDEDFFCSRCGRSGHDAEECYARSDANGRRLW
Download sequence
Identical sequences B5Y438
jgi|Phatr2|46889|estExt_fgenesh1_pg.C_chr_110298 XP_002185772.1.39622 2850.JGI46889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]