SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 289376.THEYE_A0325 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  289376.THEYE_A0325
Domain Number 1 Region: 31-92
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000109
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0059
Further Details:      
 
Weak hits

Sequence:  289376.THEYE_A0325
Domain Number - Region: 99-125
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00706
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 289376.THEYE_A0325
Sequence length 165
Comment (Thermodesulfovibrio yellowstonii DSM 11347)
Sequence
MKKILYIAGAIFAGFLAGYLSLTLFVSGGTIEVPDLRGKDIVQANQILKEKGLYIRIDGE
EYSDIPTGTVSRQSLPAGTKVKKGREVGVIMSKGLKFTVFPDVRGVSYEEAEKILNEKGI
PIEKVIKIHSNKYPDNIVIAQSPEPQQGGKAIKLIVSIGEKEEEK
Download sequence
Identical sequences B5YIL3
gi|206890406|ref|YP_002248172.1| WP_012546118.1.25233 YP_002248172.1.25208 289376.THEYE_A0325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]