SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 290633.GOX2117 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290633.GOX2117
Domain Number 1 Region: 576-1026
Classification Level Classification E-value
Superfamily ALDH-like 1.15e-125
Family ALDH-like 0.000000529
Further Details:      
 
Domain Number 2 Region: 195-544
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 5.89e-113
Family Proline dehydrohenase domain of bifunctional PutA protein 0.000000000985
Further Details:      
 
Domain Number 3 Region: 27-194
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 7.72e-58
Family N-terminal domain of bifunctional PutA protein 0.00000304
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 290633.GOX2117
Sequence length 1217
Comment (Gluconobacter oxydans 621H)
Sequence
MIIGLRPSVVSEAESMSTFVPSYPVRSSLRQAIAADMRRPEAECILPLIEQATLTETEQQ
NTFDVARHLTRTLRTQRRPGGVEALVQEFSLSSAEGVSLMCLAEALLRIPDAATRDALIR
DRIGTGDWLSHVGGKKSVFVNAASWGLMLTGKLTNDTDEGLAAALFRLVGRGGQPLVRRA
LDIAMRMMGEQFVIGETIEEARKVSTEPEERGFKYSYDMLGEAAMTEADALRYRRDYERA
IDVIGQTARGANVYEKAGISIKLSALHPRYAFAQRERVLKELGQTLKDLVIQARRYDIGI
NIDAEESERLDLSLDLIEDLCHCPELDGWNGIGIVVQAYGRRAPKVLDYLIDLGRRSGHR
LMIRLVKGAYWDSEIKKAQVEGQTDFPVYTRKCYTDVSYIACAKKLLAARDVVFPQFATH
NARTLATIYTLAGLNFQIGDYEFQCLHGMGETLYNEVVGPQKLNRPCRVYAPVGSHETLL
AYLVRRLLENGANSSFVNQIGDESLPIETLIADPVALAKAVQPPGASHPAIALPKDLFVP
ERTNSRGLDLTDEHTVTALAEAVCASEKQTLEDLSCSGETQEIRNPANHLDRIGSVRFGT
EEDVRKAIDAAESEGAAWAALSADARSTKLDRAADLLEEHQSELMALLVREAGKSYANAL
SEVREAVDFLRYYAVQARETAQAGSSAPLGVVACISPWNFPLAIFLGQISVALAAGNTVV
AKPAEETPFIALRAVALLREAGVPENALRLVPGAGETGAALVADPRISGVMFTGSTAVAG
LIASTLTSRTGADGQPVPFVAETGGQNAMIVDSSALTEQVVADVLVSAFDSAGQRCSALR
VLCVQEDCADRVLTMLRGAVEELRVGNPAELHTDVGPVISAEAQSGIQTYIDASRAQNRA
VWSLPLPDTTSNGTFIAPTIIEIDSLADLKGEVFGPVLHVLRFEASGFEALINAINQSGY
GLTFGLHTRIESRMAHVTSRIEAGNLYVNRNMVGAVVGSQPFGGEKLSGTGPKAGGPLIL
RRLMSTAPAHTDWENQELPEPARLFLSWLMRTSFPLYQTIVDAMQHGMCGTTRELPGPVG
ETNLYQLLPRGAVLCVASDRETMLRAVGLALSGGNTAFVQGPNVASDWVSDLPDALALHI
RRTQGGRVAGCRTILASPEEKQMAEQTRAALSRSGMIVQLYMLDAKSPIRPEWVLQEKVV
STNTTAAGGNASLMTIG
Download sequence
Identical sequences Q5FP43
WP_011253630.1.61435 WP_011253630.1.92951 290633.GOX2117 gi|58040545|ref|YP_192509.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]