SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 292459.STH3005 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  292459.STH3005
Domain Number - Region: 105-140
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0327
Family Phase 1 flagellin 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 292459.STH3005
Sequence length 147
Comment (Symbiobacterium thermophilum IAM14863)
Sequence
MRMFQAMEASASALTAERLRMDVIANNLANYRTTRTAEGGPYRRRTVVVEERPNTFASEL
ARQAGRPAEPGLGVRVTQIVEDPSPFKEVHDPTHPDADPVTGIVRLPNVDLLQEITDLML
AQRMYDANLTAFNAAKNMALRALEIGR
Download sequence
Identical sequences Q67K12
gi|51894141|ref|YP_076832.1| WP_011197120.1.72803 292459.STH3005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]