SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 293826.Amet_0230 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  293826.Amet_0230
Domain Number 1 Region: 55-360
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.41e-27
Family Phosphate binding protein-like 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 293826.Amet_0230
Sequence length 361
Comment (Alkaliphilus metalliredigens QYMF)
Sequence
MKKRGFLLAIAFMLAIGLLTGCAGTEPEAPTDSTPDEAVEENDESQAAGLTDPVRLVFST
QDLGTSFNSMTNAFNTVFMPELPRGSSIDVETTSPGGIAASYIISAEVADLTIGNTAPAN
WATSEGIDDRGVAEGVASLGGGFDEPVLVVIFTEAFQKRTGFTTLEEVIEAQHPVRVATK
ATGSFGEMSANKVLSLFDVTYDDIKSWGGDFTLTSSSNVVDMLRDNRADMTIDHTNINQP
NYVELSMTTPLYYVQLQDETLDRLHEMGYAYQDIAEGSFNNYVKEDIKTVGSPTALLVRE
DMDEEVAYTLTEAMAEGKSKLVTSFAAFEAFDPTKAWEPANAGAPLHPGAERYYREMGYM
K
Download sequence
Identical sequences A6TJU7
gi|150388075|ref|YP_001318124.1| WP_011971374.1.32322 293826.Amet_0230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]