SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 293826.Amet_0896 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  293826.Amet_0896
Domain Number 1 Region: 20-435
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.28e-61
Family Phosphate binding protein-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 293826.Amet_0896
Sequence length 441
Comment (Alkaliphilus metalliredigens QYMF)
Sequence
MKRMAKTVAILLALTLLLTACGGGDTPAVDTGGSEEPAGVEEEVVLRFSWWGGDERHEKT
LEAIALFEERNPGVKIEAEYGGWSGFQEKYATQMAGNTAADIMQVNWNWLYIFSKDGNGY
YDLNDLSDYVDLSNYDQAIMDQVTINNKVNALPLGIGAKVFYYNETTYAKAGVEIPKTFE
DLFAAADVFKEQLGNEYYPIDVDAYGAFLMVLYYLEQTTGQPFMNENNEINYTEGQLVEA
LEFYNEMVERGVTPSMQQRAGAGDVPVDQTPSWIQGKYGGTYEWDSAINKFQAALEGEQT
IVTGDYLKDLGSYDSALAKVSMTYAINKDTKHPEIAAQFLNFLVADPDSVALQGTARGIP
ANKAAIETLESMGMLSGLTYEGNVKATQFLGKGINPYFESGELQDLYRELIDQFGYGRIN
AQQTAERLINEVNSMTQELAQ
Download sequence
Identical sequences A6TLQ0
293826.Amet_0896 WP_012062160.1.32322 gi|150388728|ref|YP_001318777.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]