SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 293826.Amet_1164 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  293826.Amet_1164
Domain Number 1 Region: 64-333
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.69e-45
Family Phosphate binding protein-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 293826.Amet_1164
Sequence length 336
Comment (Alkaliphilus metalliredigens QYMF)
Sequence
MKAISVNKVSHFKKNVVLFGLISVLLVTLSILTGCSTGEPAPDDSSSPNTSTSTTEADPR
SDWPKTIGFALLPTEDMEFLGKTYEPFIKYLEERLDVTIELHFPTDYTATVEAMRGGHVE
ISTFGPFSFVLAHDRANAEPVAIRLTTPEDEPTYESFIITRKSTGIETVADLKDKNFAYA
DPASTSGHLFPKAHIMEQMNLSLSEVDSDFFANTVFSGSHEASFLSVLNGDVDAAAIYDR
AWTRFYERNSNHPNIDEMIVIDKTKPIPNSPFTVRGDLPESFKKELQDAMIDLINHQDDP
EILAFLQETDAMGGYFLADMSTYQIVRDTATLLEMD
Download sequence
Identical sequences A6TMF6
293826.Amet_1164 gi|150388984|ref|YP_001319033.1| WP_012062415.1.32322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]