SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 293826.Amet_2061 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  293826.Amet_2061
Domain Number 1 Region: 48-519
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.83e-121
Family Phosphate binding protein-like 0.00000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 293826.Amet_2061
Sequence length 520
Comment (Alkaliphilus metalliredigens QYMF)
Sequence
MYKKNVKWITVAILLTFLLALVGCGGAGETAGENGNGEESVVEEPRTDLIWGATQDPDTL
DPRLTTSAYSGEVLELIFNSLIYPDENLVMQFDLATGMETPDDTTYIFTLREDVKWHDGE
PFTARDVVFTYEAILDENFGSPHRSRTSVNSVEALDEYTVKFTTENPNAAAWTSLRRFIV
PAHLAPSEPYDGEEGSFGFNPVGTGPYKLTQWIPNNIITLERNDDYFEGPAILETIVRRE
IPEHETRYAELLAGNIDLAPPPERELDILNDNPDFTVVISPTLNYFPIAINHAYEGSDVL
NDVRIRQALNYAIDKESIVKHIWPTASVMHNPIMAGTWAYDDDATYKYAYNPEKAKELLA
EAGYSDGLTVSITMSNSSENVELGEMLRSYYAEVGIELQADTMEFSSALEKILNGDYQLY
HMGSTGMYDPHDFMGRFINGTGTTAYNNPEFNVLVEEAVTIIDDQDARKALYSQAQKVMT
EDAYNVPLRNSQVFMAWNKDFVYDYNYVIRSRSLKDAYWK
Download sequence
Identical sequences A6TPV4
gi|150389832|ref|YP_001319881.1| WP_012063202.1.32322 293826.Amet_2061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]