SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 293826.Amet_2810 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  293826.Amet_2810
Domain Number 1 Region: 35-288
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.27e-75
Family Phosphate binding protein-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 293826.Amet_2810
Sequence length 289
Comment (Alkaliphilus metalliredigens QYMF)
Sequence
MMKMKTLLTLLLVGVLVLAVGCQPADETPGEAAEEMGSVTLGYVSWDSEIASTNVLKVVL
EDLGYDVDMMDVSAALLYQGVAEGDFDLTTAAWLPTTHGDYINQYGAGLDDLGPNLNGTR
IGLVVPSFMDIDSIEDLATGEYAGTQITGIDPGAGIMQATEAAIDEYGLDYELLEGSDAA
MAAALNDAISYDEEVIVTGWTPHWKFASYDLKYLEDPLGIYGSDEDIHTLARVGLEDDMP
EVYAVASNFHWTPDDMAGVMVAISEGMGAEEAARQWVSENQDTVNGWLQ
Download sequence
Identical sequences A6TRZ2
293826.Amet_2810 gi|150390570|ref|YP_001320619.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]