SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 293826.Amet_3332 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  293826.Amet_3332
Domain Number 1 Region: 6-190
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 8.11e-38
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 293826.Amet_3332
Sequence length 193
Comment (Alkaliphilus metalliredigens QYMF)
Sequence
MNKLIKNIMFAGVGGQGLILMTRIISQAAMKDDFDIKSNDVVGLSQRGGMVWGNVRIGKK
IFSPNIRPGEGDILVAMEPLEALRWSAKLRDDGLIIMNSKRFYPTIVQQEKEEYPEVAIE
DLKANMNVIEINAFEEAKNLGKKQVANVMLLGILAKHLEIKVETWKETIKDNVPEKAIDL
NMQAFDLGYVYQG
Download sequence
Identical sequences A6TTE2
WP_012064425.1.32322 gi|150391070|ref|YP_001321119.1| 293826.Amet_3332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]