SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 294381.C4M4V3 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  294381.C4M4V3
Domain Number 1 Region: 145-252
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.1e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.00021
Further Details:      
 
Weak hits

Sequence:  294381.C4M4V3
Domain Number - Region: 261-288
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00977
Family Retrovirus zinc finger-like domains 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 294381.C4M4V3
Sequence length 309
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MEEVKEVDYKERFTHPGGLPIHEKRVSRWDRKIRDVLPNIPVHIPPSLDEKYWDTLAIRI
RYEELQYALGTHRLGLNTERDRTPSPPKQYNENQQEITREMRREEKLKNERLYVVDRAIE
IYPSFRIPAELAKPSGKRTKKIYFPKDRPDTNFIGLIIGPRGDNQKRLEKDSGAKISIRG
KDPKKLGKLSGYGDKDNEDSHVFITADTQEALDLACEEITKIISAPSEEINVLKHNQLRE
LALWNGTFREDRVYEVEQYESGVKCGFCGDSSHATCDCPLKKQKMSEHQLELERAFDEFM
EKIQLQLIN
Download sequence
Identical sequences A0A175JSG8 C4M4V3 M2S1C8 M3TMP3 M7X0L3 N9TDJ1
294381.C4M4V3 jCVI|EHI_193510 XP_652054.1.49425 gi|56468858|gb|EAL46666.1| gi|67472501|ref|XP_652054.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]